PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vocar.0008s0295.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Volvox
Family S1Fa-like
Protein Properties Length: 76aa    MW: 8164.67 Da    PI: 10.3968
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vocar.0008s0295.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA35.32.4e-1119741570
                 S1FA 15 livllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                         ++v+ vv g+l+  l+  y+ +       PPr kk +  k+lkreklk G+ +PG+
  Vocar.0008s0295.1.p 19 FVVVGVVFGILVSVLLYSYLAFQRMAALAPPRPKKRLGAKQLKREKLKMGIRPPGD 74
                         45666777888888888998888888899*************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046895.1E-81974IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MSTKPEADAV GDDGSYTVFV VVGVVFGILV SVLLYSYLAF QRMAALAPPR PKKRLGAKQL  60
KREKLKMGIR PPGDD*
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1418522